| Calling Sequence | GetOffset(seq)
| |||||||||
| Parameters |
| |||||||||
| Return Type | integer | |||||||||
| Synopsis | The GetOffset function finds the offset of a string whether it is in the database or outside. It is necessary when we want to pretend that a string is a sequence in the database to make it an argument of Match. The GetOffset requires that the system variable DB must be assigned a sequence database. | |||||||||
| Examples | > DB := ReadDb('/home/darwin/DB/SwissProt.Z'):;
Peptide file(/home/darwin/DB/SP45.0/SwissProt45.0(169638448), 163235 entries, 59631787 aminoacids) > CreateDayMatrices(); > s1 := 'MSRYEKMFARLNERNQGAFVPFVTVCDPNAEQSYKIMETLVESGADALELGIPFSDP': > s2 := 'MLLLSVNPPLFIPFIVAGDPSPEVTVDLALALEEAGADLLELGVPYSDP': > m3 := Match( GetOffset(s1), GetOffset(s2) ); m3 := Match(464724424,464724356) | |||||||||
| See also | MAlign, NucPepMatch, ReadDb, TotalAlign | |||||||||