| Calling Sequence
| Sequence(off)
|
| Parameters
| | Name | Type | Description |
|
| off
| {integer,list,string,structure} | entries or list of entries in the database DB |
| | Data structure of type PatEntry, AC or ID |
|
| Return Type
| Sequence |
| Synopsis
| Sequence will return the peptide or nucleotide sequence
pointed by the argument(s). This normally consists of the field
enclosed by the tags and . Sequence returns a string
or an expression sequence of strings. When the argument is an ID
or an AC structure, the database is searched for the corresponding
ID or AC. If the argument is an integer, it is taken to be a
database offset into a sequence. In this case the maximal sequence
starting at that offset is returned. Otherwise, the arguments are
treated as the arguments for Entry, and their sequences extracted. |
| Examples
| > DB := ReadDb('/home/darwin/DB/SwissProt.Z'):;
Peptide file(/home/darwin/DB/SP45.0/SwissProt45.0(169638448), 163235
entries, 59631787 aminoacids)
> s1 := Sequence(Entry(1));
s1 := MKFLILLFNILCLFPVLAADNHGVGPQGASGVDPITFDINSNQTGPAFLT ..(924).. ILVVSLIVGIL
> Sequence(PatEntry(10000..10001));
A, A
> Sequence(AC('P11341'));
MAYRGFKTSRVVKHRVRRRWFNHRRRYR
> Sequence(ID('ID5B_PROJU'));
SDRCKDLGISIDEENNRRLVVKDGDPLAVRFVKANRRG
> GetEntryNumber(s1);
1
|
| See also
| AC, Entry, ID, Match, PatEntry, SearchAC, SearchID, Species_Entry |